PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.HD5TK
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 406aa    MW: 45948.1 Da    PI: 6.9171
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.HD5TKgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like80.12.6e-25197251156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  kpr  Wt+e H+ Fv+av qL G++kA+P++ilelm+++ Lt+e+v+SHLQkYR++
  Araip.HD5TK 197 KPRFIWTQERHQMFVDAVLQL-GIDKAVPRKILELMDIPNLTRENVASHLQKYRMH 251
                  79*******************.********************************96 PP

2Response_reg51.17.5e-18351481109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.S.EHHHHHHHHHHHTTTSEEEEEESTTT..HHHHHHHH. CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.m.dGlellkeireeepklpiivvtahge..eedaleal. 90 
                   +l+vd +p  ++l++ ++ + +y +v+++ +g+ al+ll+e+   +D++l+D+ mpg m dG++ll +  +e  ++p++++ a+++  +  + e + 
   Araip.HD5TK  35 LLVVDHDPEHLRLIQDMAFQCNY-QVTTCFEGSHALNLLRESSgcFDVVLCDVHMPGiMdDGSRLLDHVLQEF-NIPVVMMCATDDesSIAVMEGMk 129
                   599********************.*********************************636*********8888.89999998777733446778999 PP

                   HTTESEEEESS--HHHHHH CS
  Response_reg  91 kaGakdflsKpfdpeelvk 109
                   k Ga   l+Kp ++++l++
   Araip.HD5TK 130 KKGACYNLVKPLSEQDLMN 148
                   9***************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.55E-2233157IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.7E-2533183No hitNo description
SMARTSM004483.7E-1133150IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011028.4334154IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.2E-1336149IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.03E-1636154No hitNo description
SuperFamilySSF466891.97E-19195254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-27195254IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-23197251IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MAANNNPHSL ADQNANSMPP PILDHQFSTT TAPRLLVVDH DPEHLRLIQD MAFQCNYQVT  60
TCFEGSHALN LLRESSGCFD VVLCDVHMPG IMDDGSRLLD HVLQEFNIPV VMMCATDDES  120
SIAVMEGMKK KGACYNLVKP LSEQDLMNIW QNVMEKTQKE VFYDDDDESK GTVNRRKRSL  180
STERDDHDVQ SNTPNKKPRF IWTQERHQMF VDAVLQLGID KAVPRKILEL MDIPNLTREN  240
VASHLQKYRM HLKKKSQETK QTNSNGKINV NREANKQLCA PLRVQASTNI PQITQTLPVH  300
HQYYSSLLSV PKQDPIIMSS KCDHHFHHQS QPIVSTAPHA LMKFCNSNSN PFGLINKNDI  360
VGSNMALNHQ NNNDYGCYII QQSNYNYGMM ASQPCDGAAF QGGMRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-19193256164ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016193006.10.0PREDICTED: two-component response regulator ARR14-like
STRINGGLYMA02G09451.12e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2095424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.16e-54response regulator 2